Links to multiple antibodies on this page for SQS: SQS SQS-pep-Test1 SQS-test2 Western result: + | | GST
 | GST-SQS A0974 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: SQS CBI Antibody Core Code: A0974 "Lot" Number: 1 Position: 100 (156-255) % Identical Homology of Target to Mouse Protein: 86% (NP_034321.2| farnesyl diphosphate farnesyl transferase 1; squalene synthase) Molecular Weight of fusion protein: 38 KDa Target sequence used to make this antibody: EFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDP
LVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEV
WSRYVKKLGDFAKPENIDLA
Antibody Name/Abbreviation: SQS-pep-Test1 CBI Antibody Core Code: A0975 "Lot" Number: 1 Position: 24 (344-367) % Identical Homology of Target to Mouse Protein: 83% (NP_034321.2| farnesyl diphosphate farnesyl transferase 1; squalene synthase) Molecular Weight of fusion protein: 29.64 KDa Target sequence used to make this antibody: EIYHRIPDSDPSSSKTRQIISTIR
Antibody Name/Abbreviation: SQS-test2 CBI Antibody Core Code: A0976 "Lot" Number: 1 Position: 60 (185-255) % Identical Homology of Target to Mouse Protein: 85% (NP_034321.2| farnesyl diphosphate farnesyl transferase 1; squalene synthase) Molecular Weight of fusion protein: 34.81 KDa Target sequence used to make this antibody: RLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQ
QGGREFWPQEVWSRYVKKLGDFAKPENIDLA
| | Sequence Name: SQS Full name: FDFT1 UniGene Number: N.A. Accession Number: NP_004453 Source organism: human ( Homo sapiens ) Full length size (aa): 417 NCBI information page: Full length sequence: mefvkclghpeefynlvrfriggkrkvmpkmdqdslssslktcykylnqt
srsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpllhnf
hsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrm
gigmaefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvged
teransmglflqktniirdyledqqggrefwpqevwsryvkklgdfakpe
nidlavqclnelitnalhhipdvitylsrlrnqsvfnfcaipqvmaiatl
aacynnqqvfkgavkirkgqavtlmmdatnmpavkaiiyqymeeiyhrip
dsdpsssktrqiistirtqnlpncqlisrshyspiylsfvmllaalswqy
latlsqvtedyvqtgeh
|