Links to multiple antibodies on this page for PASD1: PASD1 PASD1-pep-Test Western result: + | | GST
 | GST-PASD1 A0977 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: PASD1 CBI Antibody Core Code: A0977 "Lot" Number: 1 Position: 100 (476-575) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of fusion protein: 38 KDa Target sequence used to make this antibody: AFNQQQLVQQEQHLKEQQRQLREQLQQLREQRKVQKQKKM
QEKKKLQEQKMQEKKKLQEQRRQKKKKLQERKKWQGQMLQ
KEPEEEQQKQQLQEQPLKHN
Western result: + | | control
 | PASD1-pep-Test A0978 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: PASD1-pep-Test CBI Antibody Core Code: A0978 "Lot" Number: 1 Position: 20 (531-550) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 29.2 KDa Target sequence used to make this antibody: KLQEQRRQKKKKLQERKKWQ
| | Sequence Name: PASD1 Full name: PASD1 UniGene Number: N.A. Accession Number: NM_173493 Source organism: human ( Homo sapiens ) Full length size (aa): 773 NCBI information page: Full length sequence: MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLST
DGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL
NSETHIKFCCHLKRGNVEHGDSSAYENVKFIVNVRDICNEFPVVFSGLFS
SHLCADFAACVPQEDRLYLVGNVCILRTQLLQQLYTSKAVSDEAVLTQDS
DEEPFVGELSSSQGQRGHTSMKAVYVEPAAAAAAAAISDDQIDIAEVEQY
GPQENVHMFVDSDSTYCSSTVFLDTMPESPALSLQDFRGEPEVNPLYRAD
PVDLEFSVDQVDSVDQEGPMDQQDPENPVAPLDQAGLMDPVDPEDSVDLG
AAGASAQPLQPSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQN
ALELMMDHLQKQPNTLRHVVIPDLQSSEAVPKKQQKQHAGQVKRPLPHPK
DVKCFCGLSLSNSLKNTGELQEPCVAFNQQQLVQQEQHLKEQQRQLREQL
QQLREQRKVQKQKKMQEKKKLQEQKMQEKKKLQEQRRQKKKKLQERKKWQ
GQMLQKEPEEEQQKQQLQEQPLKHNVIVGNERVQICLQNPRDVSVPLCNH
PVRFLQAQPIVPVQRAAEQQPSGFYQDENCGQQEDESQSFYPEAYQGPPV
NQLPLIDTSNSEAISSSSIPQFPITSDSTISTLETPQDYIRLWQELSDSL
GPVVQVNTWSCDEQGTLHGQPTYHQVQVSEVGVEGPPDPQAFQGPAAYQP
DQMRSAEQTRLMPAEQRDSNKPC
|