human ( Homo sapiens )
G gamma10

Antibody Name/Abbreviation: G gamma10
CBI Antibody Core Code: A0390
"Lot" Number: 1 Position: 20(44-63)
% Identical Homology of Target to Mouse Protein: 95% (NP_079553.1| guanine nucleotide binding protein (G protein), gamma 10)
Molecular Weight of GST-fusion: 16.2 KDa

Target sequence used to make this antibody:
CKDALLVGVPAGSNPFREPR

Sequence Name: G gamma10
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 68
NCBI information page:

Full length sequence:
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLV
GVPAGSNPFREPRSCALL