human ( Homo sapiens )
NF-YC

Western result: +

control NF-YC-pep2-test (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: NF-YC-pep2-test
CBI Antibody Core Code: A0981
"Lot" Number: 1 Position: 20 (84-103)
% Identical Homology of Target to Mouse Protein: 90% (XP_484113.1| similar to Nuclear transcription factor Y subunit gamma (NF-Y protein chain C) (Nuclear factor YC) (NF-YC) (CCAAT-binding transcription factor subunit C) (CBF-C))
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
AWIRTEDNKRRPLQRNDIAM

Sequence Name: NF-YC
Full name:
UniGene Number: N.A.
Accession Number: P70353
Source organism: human ( Homo sapiens )
Full length size (aa): 335
NCBI information page:

Full length sequence:
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKK
IMKLDEDVKMISAEAPVLFAKGAQIFITELTLRAWIRTEDNKRRPLQRND
IAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQ
QPTAVQVQGQQQPQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQ
VQIVQAQPQGQAQQTQSGTGQTMQVMQQIITNTGETQQIPVQLNAAQLQY
IRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQEQFSQFTDGQQLYQ
IQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD