Links to multiple antibodies on this page for QRX: QRX QRX Antibody Name/Abbreviation: QRX CBI Antibody Core Code: A1001a "Lot" Number: 1 Position: 29 (120-148) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 33.19 KDa Target sequence used to make this antibody: PWLGPGPPAVPGLPRLLGPGPGLQASFGP
Antibody Name/Abbreviation: QRX CBI Antibody Core Code: A1001b "Lot" Number: 1 Position: 94 (91-184) % Identical Homology of Target to Mouse Protein: 50% (NP_038861.1| retina and anterior neural fold homeobox; eyeless 1) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: GSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVP
GLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLA
KEHAQALDRAWPPA
| | Sequence Name: QRX Full name: Q50-type retinal homeobox gene UniGene Number: N.A. Accession Number: AY211277 Source organism: human ( Homo sapiens ) Full length size (aa): 184 NCBI information page: Full length sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH
YPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRL
PEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHA
FAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
|