human ( Homo sapiens )
G gamma13

Antibody Name/Abbreviation: G gamma13
CBI Antibody Core Code: A0398
"Lot" Number: 2 Position: 20(42-61)
% Identical Homology of Target to Mouse Protein: 100% (NP_071867.1| guanine nucleotide binding protein 13, gamma; G gamma subunit, clone 2-35)
Molecular Weight of GST-fusion: 16.2 KDa

Target sequence used to make this antibody:
IPKDPFLNPDLMKNNPWVEK

Sequence Name: G gamma13
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 67
NCBI information page:

Full length sequence:
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNP
DLMKNNPWVEKGKCTIL