human ( Homo sapiens )
G gamma14

Antibody Name/Abbreviation: G gamma14
CBI Antibody Core Code: A0389
"Lot" Number: 1 Position: 20(41-60)
% Identical Homology of Target to Mouse Protein: 90% (NP_075610.1| guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
EAQAGNDPFLKGIPEDKNPF

Sequence Name: G gamma14
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 69
NCBI information page:

Full length sequence:
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFL
KGIPEDKNPFKEKGGCLIS