Links to multiple antibodies on this page for or51e2: or51e2 or51e2 Antibody Name/Abbreviation: or51e2 CBI Antibody Core Code: A1024a "Lot" Number: 1 Position: 20 (222-241) % Identical Homology of Target to Mouse Protein: 100% (NP_570936.1| olfactory receptor 78; GA_x6K02T2PBJ9-5459657-5458695; olfactory receptor MOR18-2) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: RTVLQLPSKSERAKAFGTCV
Antibody Name/Abbreviation: or51e2 CBI Antibody Core Code: A1024b "Lot" Number: 1 Position: 20 (286-305) % Identical Homology of Target to Mouse Protein: 100% (NP_570936.1| olfactory receptor 78; GA_x6K02T2PBJ9-5459657-5458695; olfactory receptor MOR18-2) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: INPIIYGAKTKQIRTRVLAM
| | Sequence Name: or51e2 Full name: UniGene Number: N.A. Accession Number: NM_030774 Source organism: human ( Homo sapiens ) Full length size (aa): 320 NCBI information page: Full length sequence: MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRT
ERSLHAPMYLFLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQM
FFIHALSAIESTILLAMAFDRYVAICHPLRHAAVLNNTVTAQIGIVAVVR
GSLFFFPLPLLIKRLAFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLT
AILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTCVSHIGVVLAF
YVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDLQAVGGK
|