Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
TypeIIA Procollagen


Antibody Name/Abbreviation: IIAPro
CBI Antibody Core Code: A1242

"Lot" Number: 1 Position: 20 (5-24)
% Identical Homology of Target to Mouse Protein: 75% (NP_112440.1| procollagen, type II, alpha 1; disproportionate micromelia)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
CVQDGQRYNDKDVWKPEPCR






Sequence Name: TypeIIA Procollagen
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 68
NCBI information page:

Full length sequence:
EAGSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDVKDCLSPE
IPFGECCPICPTDLATAS





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.