human ( Homo sapiens )
Ral B

Western result: +

GST GST-Ral B (fragment)

20.93 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Ral B
CBI Antibody Core Code: A1250
"Lot" Number: 1 Position: 63 (144-206)
% Identical Homology of Target to Mouse Protein: 69% (NP_071722.1| v-ral simian leukemia viral oncogene homolog B (ras related))
Molecular Weight of fusion protein: 20.93 KDa

Target sequence used to make this antibody:
RSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
NKDKNGKKSSKNKKSFKERCCLL

Sequence Name: Ral B
Full name: Human RAL B gene
UniGene Number: Hs.348024
Accession Number: X15015
Source organism: human ( Homo sapiens )
Full length size (aa): 206
NCBI information page: click here

Full length sequence:
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADS
YRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHES
FTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEW
GVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFK
ERCCLL