Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
PP1057


Antibody Name/Abbreviation: PP1057
CBI Antibody Core Code: A1264

"Lot" Number: 1 Position: 29 (23-51)
% Identical Homology of Target to Mouse Protein: 52% (NP_997095.1| WT1-interacting protein)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
RSFSRLRRNPQSADSGADTSGRRDSADKC






Sequence Name: PP1057
Full name: Homo sapiens hypothetical protein PP1057
UniGene Number: 157
Accession Number: NM_031285
Source organism: human ( Homo sapiens )
Full length size (aa): To be posted
NCBI information page:

Full length sequence:
MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADK
CCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLP
ENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCA
WPFCYLA





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.