Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
alpha7-2 (or XAPC7) (or RC6-1)


Antibody Name/Abbreviation: alpha7-2 (or XAPC7)
CBI Antibody Core Code: A0457

"Lot" Number: 1 Position: 20(125-144)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
SPLAAGQSRLRHGGSCHVTS






Sequence Name: alpha7-2 (or XAPC7) (or RC6-1)
Full name: proteasome alpha 7subnit isoform 2
UniGene Number: N.A.
Accession Number: NP_689468
Source organism: human ( Homo sapiens )
Full length size (aa): 166
NCBI information page: click here

Full length sequence:
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSV
AKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED
PVTVEYITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSALYAEQ
WAQAVWHLCPHRGFRL





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.