human ( Homo sapiens )
PE22

Western result: +

control PE22 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: PE22
CBI Antibody Core Code: A0550
"Lot" Number: 1 Position: 24(1-24)
% Identical Homology of Target to Mouse Protein: 60% (NP_032990.1| prostaglandin E receptor 2 (subtype EP2); EP2 receptor; prostaglandin E receptor EP2 subtype; prostaglandin E receptor 2 (EP2 subtype))
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
MGNASNDSQSEDCETRQWLPPGES

Sequence Name: PE22
Full name: Prostaglandin E2 receptor, EP2 subtype (Prostanoid EP2 receptor) (PGE receptor, EP2 subtype).
UniGene Number: Hs.2090
Accession Number: P43116
Source organism: human ( Homo sapiens )
Full length size (aa): 358
NCBI information page: click here

Full length sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRW
RGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLV
ALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSA
SGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLY
ATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRR
GERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQS
DASKQADL