human ( Homo sapiens )
ALY

Western result: +

GST GST-ALY (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: ALY
CBI Antibody Core Code: A0595
"Lot" Number: 1 Position: 100(114-213)
% Identical Homology of Target to Mouse Protein: 93% (NP_035698.1| THO complex 4; Tcra enhancer-binding factor interacting protein 1; RNA and export factor binding protein 1)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
HYDRSGRSLGTANVHFERKADALKAMKQYNGFPLDGRPMN
IQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRR
GTRGGARGRGRGAGRNSKQQ

Sequence Name: ALY
Full name: transcriptional coactivator ALY
UniGene Number: N.A.
Accession Number: AAD09608
Source organism: human ( Homo sapiens )
Full length size (aa): 233
NCBI information page: click here

Full length sequence:
GRRGRGRAGSRAGRRGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRP
APYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQE
LFAEFGTLKKAAVHYDRSGRSLGTANVHFERKADALKAMKQYNGFPLDGR
PMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGAR
GRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS