human ( Homo sapiens )
S10

Western result: +

control S10 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: S10
CBI Antibody Core Code: A0446
"Lot" Number: 1 Position: 19(354-372)
% Identical Homology of Target to Mouse Protein: 100% (NP_079826.2| proteasome, 26S, non-ATPase regulatory subunit 6)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
VETNRPDSKNWQYQETIKK

Sequence Name: S10
Full name: 26S proteasome regulatory subunit S10; Proteasome regulatory particle subunit p44S10; 26S proteasome non-ATPase regulatory subunit 6
UniGene Number: N.A.
Accession Number: Q15008
Source organism: human ( Homo sapiens )
Full length size (aa): 389
NCBI information page: click here

Full length sequence:
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNM
APYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEI
RDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLF
YMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAEL
FLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVL
HSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV
NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM