Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
Serum Amyloid A1 (SAA1)


Antibody Name/Abbreviation: Serum Amyloid A1 (SAA1)
CBI Antibody Core Code: A0082

"Lot" Number: 1 Position: 76(1-76)
% Identical Homology of Target to Mouse Protein: 75% (NP_035444.1| serum amyloid A 2)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARG
NYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDS






Sequence Name: Serum Amyloid A1 (SAA1)
Full name: Serum Amyloid A1 (SAA1)
UniGene Number: N.A.
Accession Number: M23698
Source organism: human ( Homo sapiens )
Full length size (aa): 104
NCBI information page: click here

Full length sequence:
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPG
GVWAAEAISDARENIQRFFGHGAEDS^LADQAANEWGRSGKDPNHFRPAG
LPEKY





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.