| Antibody Name/Abbreviation: Serum Amyloid A1 (SAA1) CBI Antibody Core Code: A0082 "Lot" Number: 1 Position: 76(1-76) % Identical Homology of Target to Mouse Protein: 75% (NP_035444.1| serum amyloid A 2) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARG
NYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDS
| | Sequence Name: Serum Amyloid A1 (SAA1) Full name: Serum Amyloid A1 (SAA1) UniGene Number: N.A. Accession Number: M23698 Source organism: human ( Homo sapiens ) Full length size (aa): 104 NCBI information page: click here Full length sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPG
GVWAAEAISDARENIQRFFGHGAEDS^LADQAANEWGRSGKDPNHFRPAG
LPEKY
|