human ( Homo sapiens )
TN12 (TWEAK12)

Western result: +

control TN12 (TWEAK12) (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: TN12 (TWEAK12)
CBI Antibody Core Code: A0549
"Lot" Number: 1 Position: 20(63-82)
% Identical Homology of Target to Mouse Protein: 72% (NP_035744.1| tumor necrosis factor (ligand) superfamily, member 12)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
EEDQDPSELNPQTEESQDPA

Sequence Name: TN12 (TWEAK12)
Full name: Tumor necrosis factor ligand superfamily member 12 (TNF-related weak inducer of apoptosis) (TWEAK) (APO3 ligand).
UniGene Number: N.A.
Accession Number: O43508; Q8WUZ7
Source organism: human ( Homo sapiens )
Full length size (aa): 249
NCBI information page: click here

Full length sequence:
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASL
SAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRK
TRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQI
GEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAA
SSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH