Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
TNFb



Western result: +
GST
GST-TNFb
(fragment)

N.A. kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: TNFb
CBI Antibody Core Code: 1Ab063

"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: N.A.
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted






Sequence Name: TNFb
Full name:
UniGene Number: N.A.
Accession Number: L11015
Source organism: human ( Homo sapiens )
Full length size (aa): To be posted
NCBI information page: click here

Full length sequence:
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQD
QGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQ
GLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGG
DPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPL
WYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.