human ( Homo sapiens )
UAP56 (THOC4)

Western result: +

GST GST-UAP56 (THOC4) (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: UAP56 (THOC4)
CBI Antibody Core Code: A0593
"Lot" Number: 2 Position: 100(137-236)
% Identical Homology of Target to Mouse Protein: 92% (NP_035698.1| THO complex 4; Tcra enhancer-binding factor interacting protein 1; RNA and export factor binding protein 1)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
YDRSGRSLGTANVHFERKADALKAMKQYNGFPLDGRPMNI
QLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRG
TRGGARGRGRGAGRNSKQQL

Sequence Name: UAP56 (THOC4)
Full name: transcriptional coactivator; bZIP enhancing factor
UniGene Number: N.A.
Accession Number: NP_005773
Source organism: human ( Homo sapiens )
Full length size (aa): 255
NCBI information page: click here

Full length sequence:
MADKMDMSLDDIIKLNRSQRGGRGGGRGRAGSRAGRRGGAQAAARVNRGG
GPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGV
ETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTANVH
FERKADALKAMKQYNGFPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTR
NRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNA
RMDTS