| Western result: + | | | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: UCH37 CBI Antibody Core Code: A0787 "Lot" Number: 1 Position: 100(196-295) % Identical Homology of Target to Mouse Protein: 95% (NP_062508.1| ubiquitin C-terminal hydrolase 37; biquitin carboxyl-terminal esterase L5) Molecular Weight of fusion protein: 38 KDa Target sequence used to make this antibody: WISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI
AELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEV
QKLKRYKIENIRRKHNYLPF
| | Sequence Name: UCH37 Full name: ubiquitin carboxyl-terminal hydrolase L5 UniGene Number: Hs.187357 Accession Number: NM_015984 Source organism: human ( Homo sapiens ) Full length size (aa): 329 NCBI information page: click here Full length sequence: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVH
GLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNC
THQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFE
FDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAV
RPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDT
DQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
|