human ( Homo sapiens )
beta1

Western result: +

GST GST-beta1 (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: beta1
CBI Antibody Core Code: A0458
"Lot" Number: 1 Position: 100(142-241)
% Identical Homology of Target to Mouse Protein: 98% (NP_035315.1| proteasome (prosome, macropain) subunit, beta type 1)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
DEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQV
GFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDAL
RICIVTKEGIREETVSLRKD

Sequence Name: beta1
Full name: Proteasome subunit beta type 1 (Proteasome component C5) (Macropain subunit C5) (Multicatalytic endopeptidase complex subunit C5) (Proteasome gamma chain)
UniGene Number: N.A.
Accession Number: P20618
Source organism: human ( Homo sapiens )
Full length size (aa): 241
NCBI information page: click here

Full length sequence:
MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAI
VASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARL
KMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVY
SFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAM
RLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD