human ( Homo sapiens )
ELOB (TCEB2)

Western result: +

GST GST-ELOB (TCEB2) (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: ELOB (TCEB2)
CBI Antibody Core Code: A0366
"Lot" Number: 1 Position: 100(19-118)
% Identical Homology of Target to Mouse Protein: 97% (NP_080581.1| transcription elongation factor B (SIII), polypeptide 2; 18 kDa, elongin B; transcription elongation factor B (SIII), polypeptide 2 (18 kDa, elongin B))
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
KESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLG
ECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPE
LPDVMKPQDSGSSANEQAVQ

Sequence Name: ELOB (TCEB2)
Full name: transcription elongation factor B (SIII),polypeptide 2 (18kDa, elongin B)
UniGene Number: N.A.
Accession Number: NM_007108
Source organism: human ( Homo sapiens )
Full length size (aa): 118
NCBI information page: click here

Full length sequence:
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQL
LDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELP
DVMKPQDSGSSANEQAVQ