Links to multiple antibodies on this page for IFN-g: IFN-g-FuseLinker (test) IFN-g-Fuse-NoLinker(test) IFN-g-pepA(test) IFN-g-pepB(test) IFN-g-pepC(test) IFN-g-pepD(test) Antibody Name/Abbreviation: IFN-g-FuseLinker (test) CBI Antibody Core Code: A0804 "Lot" Number: 1 Position: 85(fuse with linker (18-33|46-66|105-117|147-166) % Identical Homology of Target to Mouse Protein: 31% (NP_032363.1| interferon gamma) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: SLGCYCQDPYVKEAENGGGGSADNGTLFLGILKNWKEESD
RKGGGGSFNSNKKKRDDFEKGGGGSAKTGKRKRSQMLFQG
RRASQ
Antibody Name/Abbreviation: IFN-g-Fuse-NoLinker(test) CBI Antibody Core Code: A0805 "Lot" Number: 1 Position: 70(fuse without linker(18-33|46-66|105-117|147-166) % Identical Homology of Target to Mouse Protein: 30% (NP_032363.1| interferon gamma) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: SLGCYCQDPYVKEAENADNGTLFLGILKNWKEESDRKFNS
NKKKRDDFEKAKTGKRKRSQMLFQGRRASQ
Antibody Name/Abbreviation: IFN-g-pepA(test) CBI Antibody Core Code: A0806 "Lot" Number: 1 Position: 16(18-33) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: SLGCYCQDPYVKEAEN
Antibody Name/Abbreviation: IFN-g-pepB(test) CBI Antibody Core Code: A0807 "Lot" Number: 1 Position: 21(46-66) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: ADNGTLFLGILKNWKEESDRK
Antibody Name/Abbreviation: IFN-g-pepC(test) CBI Antibody Core Code: A0808 "Lot" Number: 1 Position: 13(105-117) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: FNSNKKKRDDFEK
Antibody Name/Abbreviation: IFN-g-pepD(test) CBI Antibody Core Code: A0809 "Lot" Number: 1 Position: 20(147-166) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: AKTGKRKRSQMLFQGRRASQ
| Sequence Name: IFN-g Full name: interferon IFN-gamma UniGene Number: Hs.856 Accession Number: X13274 Source organism: human ( Homo sapiens ) Full length size (aa): 166 NCBI information page: Full length sequence: MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGT
LFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDM
NVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTG
KRKRSQMLFQGRRASQ
|