human ( Homo sapiens )
GPR64

Western result: +

GST GST-GPR64 A0836 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: GPR64
CBI Antibody Core Code: A0836
"Lot" Number: 1 Position: 100(242-341)
% Identical Homology of Target to Mouse Protein: 41% (NP_848827.1| G protein-coupled receptor 64; LNB-TM7 heptahelical receptor Me6)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
CLADHPRGPPFSSSQSIPVVPRATVLSQVPKATSFAEPPD
YSPVTHNVPSPIGEIQPLSPQPSAPIASSPAIDMPPQSET
ISSPMPQTHVSGTPPPVKAS

Western result: +

control GPR64-pep1 A0838 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: GPR64-pep1
CBI Antibody Core Code: A0838
"Lot" Number: 1 Position: 20(123-142)
% Identical Homology of Target to Mouse Protein: 50% (NP_848827.1| G protein-coupled receptor 64; LNB-TM7 heptahelical receptor Me6)
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
IMFQYDKESTVPQNQHITNG

Western result: +

control GPR64-pep3 A0840 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: GPR64-pep3
CBI Antibody Core Code: A0840
"Lot" Number: 1 Position: 20(275-294)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
SFAEPPDYSPVTHNVPSPIG

Western result: +

control GPR64-pep4 A0841 (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: GPR64-pep4
CBI Antibody Core Code: A0841
"Lot" Number: 1 Position: 20(313-332)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
IDMPPQSETISSPMPQTHVS

Western result: +

GST GST-GPR64-fuse5x20 A0837 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: GPR64-fuse5x20
CBI Antibody Core Code: A0837
"Lot" Number: 2 Position: 100 fuse(123-142|242-261|275-294|313-332|570-589)
% Identical Homology of Target to Mouse Protein: 81% (NP_848827.1| G protein-coupled receptor 64; LNB-TM7 heptahelical receptor Me6)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
IMFQYDKESTVPQNQHITNGCLADHPRGPPFSSSQSIPVV
SFAEPPDYSPVTHNVPSPIGIDMPPQSETISSPMPQTHVS
WDLGRNGGRGGWSDNGCSVK

Sequence Name: GPR64
Full name: Seven transmembrane-domain receptor
UniGene Number: Hs.421137
Accession Number: NM_005756
Source organism: human ( Homo sapiens )
Full length size (aa): 1014
NCBI information page:

Sequence Notes: A0840, A0841: This antibody was generated from mice that were immunized with a mixed peptides from different regions of the antigen sequence. Serum was tested on individual peptide.

Full length sequence:
MVFSVRQCGHVGRTEEVLLTFKIFLVIICLHVVLVTSLEEDTDNSSLSPP
PAKLSVVSFAPSSNEVETTSLNDVTLSLLPSNETEKTKITIVKTFNASGV
KPQRNICNLSSICNDSAFFRGEIMFQYDKESTVPQNQHITNGTLTGVLSL
SELKRSELNKTLQTLSETYFIMCATAEAQSTLNCTFTIKLNNTMNACAAI
AALERVKIRPMEHCCCSVRIPCPSSPEELGKLQCDLQDPIVCLADHPRGP
PFSSSQSIPVVPRATVLSQVPKATSFAEPPDYSPVTHNVPSPIGEIQPLS
PQPSAPIASSPAIDMPPQSETISSPMPQTHVSGTPPPVKASFSSPTVSAP
ANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMIN
QVSRLLHSPPDMLAPLAQRLLKVVDDIGLQLNFSNTTISLTSPSLALAVI
RVNASSFNTTTFVAQDPANLQVSLETQAPENSIGTITLPSSLMNNLPAHD
MELASRVQFNFFETPALFQDPSLENLSLISYVISSSVANLTVRNLTRNVT
VTLKHINPSQDELTVRCVFWDLGRNGGRGGWSDNGCSVKDRRLNETICTC
SHLTSFGVLLDLSRTSVLPAQMMALTFITYIGCGLSSIFLSVTLVTYIAF
EKIRRDYPSKILIQLCAALLLLNLVFLLDSWIALYKMQGLCISVAVFLHY
FLLVSFTWMGLEAFHMYLALVKVFNTYIRKYILKFCIVGWGVPAVVVTII
LTISPDNYGLGSYGKFPNGSPDDFCWINNNAVFYITVVGYFCVIFLLNVS
MFIVVLVQLCRIKKKKQLGAQRKTSIQDLRSIAGLTFLLGITWGFAFFAW
GPVNVTFMYLFAIFNTLQGFFIFIFYCVAKENVRKQWRRYLCCGKLRLAE
NSDWSKTATNGLKKQTVNQGVSSSSNSLQSSSNSTNSTTLLVNNDCSVHA
SGNGNASTERNGVSFSVQNGDVCLHDFTGKQHMFNEKEDSCNGKGRMALR
RTSKRGSLHFIEQM