| Western result: + | | control
 | BIGM103 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: BIGM103 CBI Antibody Core Code: A0868 "Lot" Number: 1 Position: 20(108-127) % Identical Homology of Target to Mouse Protein: 60% (NP_080504.2| solute carrier family 39 (metal ion transporter), member 8) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: LNFHPCEDRPKHKTRPSHSE
| | Sequence Name: BIGM103 Full name: BCG induced integral membrane protein BIGMo-103 (Up-regulated by BCG-CWS) (Hypothetical protein) UniGene Number: Hs.284205 Accession Number: NM_022154 Source organism: human ( Homo sapiens ) Full length size (aa): 460 NCBI information page: Full length sequence: MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQH
LLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVI
CPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILT
PLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAV
AVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPA
INGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI
GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELG
DFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAG
GMFLYISLADMFPEMNDMLREKVTGRKTDFTFFMIQNAGMLTGFTAILLI
TLYAGEIELE
|