| Antibody Name/Abbreviation: IL4 CBI Antibody Core Code: A0870 "Lot" Number: 1 Position: 20(128-147) % Identical Homology of Target to Mouse Protein: 52% (NP_075630.1| torsin family 3, member A; ATP-dependant interferon responsive) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MESLRRTMQKKYWQCGSSTF
| | Sequence Name: IL4 Full name: Interleukin 4 UniGene Number: N.A. Accession Number: N.A. Source organism: deer mouse ( Peromyscus maniculatus ) Full length size (aa): 147 NCBI information page: Full length sequence: MGLSPQLAAILLWLLACTGHYTLGCNDKALKEIIHILNQVTEKGTPCTEM
VVPDVLTARKNTTEKELICRASQVLRKFYFPHEVTPCLKNNSGVLKALKR
LHRGISNLSPQKSCTGNESTHTTLKDFMESLRRTMQKKYWQCGSSTF
|