malaria parasite (malaria (P. falciparum)) ( Plasmodium falciparum )
DLC2

Western result: +-

GST GST-DLC2 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: DLC2
CBI Antibody Core Code: A0479
"Lot" Number: 1 Position: 100(1-100)
% Identical Homology of Target to Mouse Protein: 48% (XP_356594.2| RIKEN cDNA E330027P08)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
MSRTMAKEATFSNCIKNWEQKNGKKICDEEEVSFICNIPL
IEKLDNSINTLEKCKRLSLSTNRIEKLIPMSGLKNIEILS
LGRNCIKKIQYLEDISGTLK

Sequence Name: DLC2
Full name: dynein light chain
UniGene Number: N.A.
Accession Number: MAL8P1.46
Source organism: malaria parasite (malaria (P. falciparum)) ( Plasmodium falciparum )
Full length size (aa): 199
NCBI information page: click here

Full length sequence:
MSRTMAKEATFSNCIKNWEQKNGKKICDEEEVSFICNIPLIEKLDNSINT
LEKCKRLSLSTNRIEKLIPMSGLKNIEILSLGRNCIKKIQYLEDISGTLK
QLWLSYNYIDKLDNLQSLKKLQVLYIFHNKIKSIEEIDKLNTLPELVELG
LKGNPIYEGKTNEYMKLLILKKLPQLKIVDNETITEKQRNDALTFEILP