Links to multiple antibodies on this page for rMyo: rMyocardin rMyocardin Western result: +?? | | GST
 | GST-rMyocardin A1043a (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: rMyocardin CBI Antibody Core Code: A1043a "Lot" Number: 1 Position: 72 (867-938) % Identical Homology of Target to Mouse Protein: 100% (NP_666498.1| SRF co-factor protein (cardiac and smooth muscle) isoform 1; transcription factor myocardin; SRF co-factor protein (cardiac and smooth muscle)) Molecular Weight of fusion protein: 21.92 KDa Target sequence used to make this antibody: QLSPPSVDSSGLQLSFTESPWETMEWLDLTPPSSTPGFSN
LTSSGPSIFNIDFLDVTDLNLNSPMDLHLQQW
Western result: + | | control
 | rMyocardin A1043b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: rMyocardin CBI Antibody Core Code: A1043b "Lot" Number: 1 Position: 20 (888-907) % Identical Homology of Target to Mouse Protein: 100% (NP_666498.1| SRF co-factor protein (cardiac and smooth muscle) isoform 1; transcription factor myocardin; SRF co-factor protein (cardiac and smooth muscle)) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: ETMEWLDLTPPSSTPGFSNL
| | Sequence Name: rMyo Full name: Rat myocardin UniGene Number: N.A. Accession Number: NP_872608 Source organism: Norway rat (Rat) ( Rattus norvegicus ) Full length size (aa): 938 NCBI information page: Full length sequence: mtllgsehsllirrkfrsvlqlrlqqrrtqeqlanqglipplksptefhd
prkkldsaktedslrrkvrnrsdraslvnmhilqastaersiptaqmklk
rarladdlnekialrpgplelveknilpmdssvkeaikgtevslskaada
fafeddssrdglspdqarsedpqgsggstpdiksteaplagpldtiqdlt
pgsesdkndtasqlsnqsdsgkqvlgplstpipvhtavkskslgdsknrh
kkpkdpkpkvkklkyhqyippdqkaekspppmdsayarllqqqqlflqlq
ilsqqqqqqqqqqqqqqqqqqqqrfsypgmhqahlkepneqmtrnpnsss
tplnntplspvknslsgqtgvsslkpgplppnlddlkvselrqqlrirgl
pvsgtktalvdrlrpfqdcagnpvpnfgdittvtfpvtpntlpsyqssps
gfyhfgstsssppispassdlsaagslpdtftdaspgfglhaspvpactd
esllsslnggsgpsepdgldsekdkmlvekqkvinqltwklrqeqrqvee
lrmqlqkqksgcndqkplpflattikqedvsscpfaaqqasgkgqghssd
spppacetaqllphcvessgqthvlsstflspqcspqhsplgtlkspqhi
slppspnnhyflasssgaqrenhgvsspnssqgcaqmtglqssdkvgptf
sipsptfpkssptvpeitqppsyedavkqqmtrsqqmdelldvliesgem
padaredhsclqkipkipgsscspttilpkssasfeqassggqisfdhya
tdseehlevllnshspigkvsdvtllkigseeppfdgimdgfpgkaaedl
fsahellpgplspmhtqlsppsvdssglqlsftespwetmewldltppss
tpgfsnltssgpsifnidfldvtdlnlnspmdlhlqqw
|