Norway rat (Rat) ( Rattus norvegicus )
rArg2

Western result: ++

GST GST-rArg2 A0363 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: rArg2
CBI Antibody Core Code: A0363
"Lot" Number: 1 Position: 100(30-129)
% Identical Homology of Target to Mouse Protein: 93% (NP_033835.1| arginase type II)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
GAPFSRGQKKKGVEYGPAAIREAGLLKRLSMLGCHIKDFG
DLSFTNVPKDDPYNNLVVYPRSVGIANQELAEVVSRAVSG
GYSCVTLGGDHSLAIGTISG

Western result: +

control rArg2pep A0364 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: rArg2pep
CBI Antibody Core Code: A0364
"Lot" Number: 1 Position: 20(331-350)
% Identical Homology of Target to Mouse Protein: 90% (NP_033835.1| arginase type II)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
HIAYDHLPTPSSPHESEKEE

Sequence Name: rArg2
Full name: Arginase
UniGene Number: N.A.
Accession Number: NM_019168
Source organism: Norway rat (Rat) ( Rattus norvegicus )
Full length size (aa): 354
NCBI information page: click here

Full length sequence:
MFLRSSVSRLLHGQIPCALTRSVHSVAVVGAPFSRGQKKKGVEYGPAAIR
EAGLLKRLSMLGCHIKDFGDLSFTNVPKDDPYNNLVVYPRSVGIANQELA
EVVSRAVSGGYSCVTLGGDHSLAIGTISGHARHHPDLCVIWVDAHADINT
PLTTVSGNIHGQPLSFLIRELQDKVPQLPGFSWIKPCLSPPNLVYIGLRD
VEPAEHFILKSFDIQYFSMRDIDRLGIQKVMEQTFDRLIGKRKRPIHLSF
DIDAFDPKLAPATGTPVVGGLTYREGLYITEEIHSTGLLSALDLVEVNPH
LATSEEEAKATASLAVDVIASSFGQTREGGHIAYDHLPTPSSPHESEKEE
CVRI