Norway rat (Rat) ( Rattus norvegicus )
RAB38

Western result: +

control RAB38 A0875 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: RAB38
CBI Antibody Core Code: A0875
"Lot" Number: 1 Position: 20(182-201)
% Identical Homology of Target to Mouse Protein: 90% (NP_082514.4| Rab38, member of RAS oncogene family; chocolate)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
CDFIESIEPDIVKPHLTSPK

Antibody Name/Abbreviation: RAB38-pep
CBI Antibody Core Code: A0876
"Lot" Number: 1 Position: 10(1-10)
% Identical Homology of Target to Mouse Protein: 100% (NP_082514.4| Rab38, member of RAS oncogene family; chocolate)
Molecular Weight of GST-fusion: 28.1 KDa

Target sequence used to make this antibody:
MQTPHKEHLY

Antibody Name/Abbreviation: RAB38
CBI Antibody Core Code: A1021
"Lot" Number: 1 Position: 20 (102-121)
% Identical Homology of Target to Mouse Protein: 100% (NP_082514.4| Rab38, member of RAS oncogene family; chocolate)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
AKWKNDLDSKLTLPNGKPVS

Sequence Name: RAB38
Full name: Rab38, member of RAS oncogene family
UniGene Number: N.A.
Accession Number: NP_665717
Source organism: Norway rat (Rat) ( Rattus norvegicus )
Full length size (aa): 211
NCBI information page:

Full length sequence:
MQTPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV
LHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEA
VAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLVNNGLKMDQFCKEH
GFVGWFETSAKENINIDEASRCLVKHILANECDFIESIEPDIVKPHLTSP
KVVSCSGCAKS