Links to multiple antibodies on this page for Rad14: yRad14 yRad14 Western result: + | | control
 | yRad14 A1066b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: yRad14 CBI Antibody Core Code: A1066b "Lot" Number: 1 Position: 20 (288-307) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: DEEWQRREEGKAHRREKKYE
Antibody Name/Abbreviation: yRad14 CBI Antibody Core Code: A1066a "Lot" Number: 1 Position: 100 (88-187) % Identical Homology of Target to Mouse Protein: 33% (XP_485461.1| PREDICTED: ubiquitin specific protease 31) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: GVVDGSKRDASVLDKRPTDRIRPSIRKQDYIEYDFATMQN
LNGGYINPKDKLPNSDFTDDQEFESEFGSKKQKTLQDWKK
EQLERKMLYENAPPPEHISK
| | Sequence Name: Rad14 Full name: UniGene Number: N.A. Accession Number: YMR201C Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) Full length size (aa): 371 NCBI information page: Full length sequence: MTPEQKAKLEANRKLAIERLRKRGILSSDQLNRIESRNEPLKTRPLAVTS
GSNRDDNAAAAVHVPNHNGQPSALANTNTNTTSLYGSGVVDGSKRDASVL
DKRPTDRIRPSIRKQDYIEYDFATMQNLNGGYINPKDKLPNSDFTDDQEF
ESEFGSKKQKTLQDWKKEQLERKMLYENAPPPEHISKAPKCIECHINIEM
DPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTDPELNDEDLFH
RLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAH
RREKKYEKKIKEMRLKTRAQEYTNRLREKKHGKAHIHHFSDPVDGGIDED
GYQIQRRRCTDCGLETEEIDI
|