| Antibody Name/Abbreviation: CPR1/YDR155C CBI Antibody Core Code: A1422 "Lot" Number: 1 Position: 38 (70-107) % Identical Homology of Target to Mouse Protein: 81% (NP_080628.1| peptidylprolyl isomerase D) Molecular Weight of fusion protein: 18.18 KDa Target sequence used to make this antibody: GTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNG
| | Sequence Name: CPR1/YDR155C Full name: UniGene Number: N.A. Accession Number: N.A. Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) Full length size (aa): 162 NCBI information page: Full length sequence: MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSP
FHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMAN
AGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGAT
KARIVVAKSGEL
|