Return to CBI Antibody Core Home Page
  Return to yeast list
    Return to Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) list


Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
yEK1 (YpL1046cp)


Antibody Name/Abbreviation: yEK1 (YPL046Cp)
CBI Antibody Core Code: A0308

"Lot" Number: 2 Position: 99(1-99)
% Identical Homology of Target to Mouse Protein: 32% (NP_080732.1| transcription elongation factor B (SIII), polypeptide 1; elongin C)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRES
KGRIELKQFDSHILEKAVEYLNYNLKYSGVSEDDDEIPEF
EIPTEMSLELLLAADYLSI






Sequence Name: yEK1 (YpL1046cp)
Full name: YPL046C/ELC1
UniGene Number: N.A.
Accession Number: AAB68175.1
Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Full length size (aa): 99
NCBI information page: click here

Full length sequence:
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFD
SHILEKAVEYLNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.