Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Pup3

Western result: +/-

GST GST-Pup3 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Pup3
CBI Antibody Core Code: A0233
"Lot" Number: 1 Position: 100(61-160)
% Identical Homology of Target to Mouse Protein: 52% (NP_036101.1| proteasome beta 3 subunit; proteasome (prosome, macropain) subunit, beta type, 3)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
TTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRF
GPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSG
TASDQLFGMCESLYEPNLEP

Sequence Name: Pup3
Full name: 20S proteasome subunit beta3_sc
UniGene Number: N.A.
Accession Number: NP_011020
Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Full length size (aa): 205
NCBI information page: click here

Full length sequence:
MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVF
LGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRF
GPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMC
ESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYL
KMRQD