Links to multiple antibodies on this page for zdbp1/dlm1: zdbp1/dlm1 zdbp1/dlm1 Western result: + | | GST
 | GST-zdbp1/dlm1 A1013a (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: zdbp1/dlm1 CBI Antibody Core Code: A1013a "Lot" Number: 1 Position: 100 (312-411) % Identical Homology of Target to Mouse Protein: 100% (NP_067369.1| Z-DNA binding protein 1; tumor stroma and activated macrophage protein DLM-1) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: CFLEDATIGNGNKMTIHLRSKGEVMESGDSEEPKKEDTGT
SSEATPPRSCQHTPSDSMLPTSELRAMALGDSSPQTTEPV
LREHEVQDIESSQDTGLSKQ
Antibody Name/Abbreviation: zdbp1/dlm1 CBI Antibody Core Code: A1013b "Lot" Number: 1 Position: 100 (120-219) % Identical Homology of Target to Mouse Protein: 100% (NP_067369.1| Z-DNA binding protein 1; tumor stroma and activated macrophage protein DLM-1) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: EVNPLLYSMRNKHLLSYDGQTWKIYHSRQEGQDIAHSGVT
QESPAIICQHNPVNMICQQGANSHISIANSNAIQIGHGNV
IVREKACGEPGPRTSHPLPL
| | Sequence Name: zdbp1/dlm1 Full name: zDNA binding protein UniGene Number: N.A. Accession Number: af136520 Source organism: mouse ( Mus musculus ) Full length size (aa): 411 NCBI information page: Full length sequence: maeapvdlstgdnleqkilqvlsddggpvkigqlvkkcqvpkktlnqvly
rlkkedrvsspepatwsiggaasgdgapaipenssaqpslderilrflea
ngphralhiakalgmttakevnpllysmrnkhllsydgqtwkiyhsrqeg
qdiahsgvtqespaiicqhnpvnmicqqganshisiansnaiqighgnvi
vrekacgepgprtshplplawdasaqdmppvahgaqyiymdksllqqvql
ghhnemslvgdagkhpsysfsdsppevstttadpgasfnmqtfepgphpe
gdtvqtvhikscfledatigngnkmtihlrskgevmesgdseepkkedtg
tsseatpprscqhtpsdsmlptselramalgdsspqttepvlrehevqdi
essqdtglskq
|