mouse ( Mus musculus )
RetnLa

Antibody Name/Abbreviation: RetnLa
CBI Antibody Core Code: A1014b
"Lot" Number: 1 Position: 20 (39-58)
% Identical Homology of Target to Mouse Protein: 100% (NP_065255.1| resistin like alpha; hypoxia-induced mitogenic factor; found in inflammatory zone 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
LANPANYPSTVTKTLSCTSV

Antibody Name/Abbreviation: RetnLa
CBI Antibody Core Code: A1014a
"Lot" Number: 1 Position: 20 (78-97)
% Identical Homology of Target to Mouse Protein: 100% (NP_065255.1| resistin like alpha; hypoxia-induced mitogenic factor; found in inflammatory zone 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
CGFACGSWEIQSGDTCNCLC

Sequence Name: RetnLa
Full name: Resistin like alpha
UniGene Number: N.A.
Accession Number: NM_020509
Source organism: mouse ( Mus musculus )
Full length size (aa): 111
NCBI information page:

Full length sequence:
MKTTTCSLLICISLLQLMVPVNTDETIEIIVENKVKELLANPANYPSTVT
KTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLV
DWTTARCCQLS