mouse ( Mus musculus )
mKlf7

Western result: +

control mKlf7 A1018a (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: mKlf7
CBI Antibody Core Code: A1018a
"Lot" Number: 1 Position: 20 (38-57)
% Identical Homology of Target to Mouse Protein: 100% (NP_291041.2| Kruppel-like factor 7 (ubiquitous))
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
ELERYLQTEPRRISETFGED

Antibody Name/Abbreviation: mKlf7
CBI Antibody Core Code: A1018b
"Lot" Number: 2 Position: 27 (112-136)
% Identical Homology of Target to Mouse Protein: 100% (NP_291041.2| Kruppel-like factor 7 (ubiquitous))
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
LQPTSSSLDSYTAVNQAQLNAVTSL

Sequence Name: mKlf7
Full name:
UniGene Number: N.A.
Accession Number: AAK31139
Source organism: mouse ( Mus musculus )
Full length size (aa): 301
NCBI information page:

Full length sequence:
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRI
SETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLS
RDKLLSETCLSLQPTSSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVK
TSQTLSAVDGTVTLKLVAKKASLSSVKVGGVAAAAAVTPAGAVKSGQSDS
EQGGGGADTCPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKC
SWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRH
I