mouse ( Mus musculus )
Ndufs4

Western result: +

GST GST-Ndufs4 A1072a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Ndufs4
CBI Antibody Core Code: A1072a
"Lot" Number: 1 Position: 100 (63-162)
% Identical Homology of Target to Mouse Protein: 87% (NP_035017.1| NADH dehydrogenase (ubiquinone) Fe-S protein 4; NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18 kDa))
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
KVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWA
STADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKP
KSKSYGANFSWNKRTRVSTK

Antibody Name/Abbreviation: Ndufs4
CBI Antibody Core Code: A1072b
"Lot" Number: 1 Position: 20 (67-86)
% Identical Homology of Target to Mouse Protein: 100% (NP_035017.1| NADH dehydrogenase (ubiquinone) Fe-S protein 4; NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18 kDa))
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
FVPARNNMQSGVNNTKKWKM

Sequence Name: Ndufs4
Full name:
UniGene Number: N.A.
Accession Number: NM_010887
Source organism: mouse ( Mus musculus )
Full length size (aa): 162
NCBI information page:

Full length sequence:
MLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITT
LTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMG
WASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGAN
FSWNKRTRVSTK