Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
mCalci


Antibody Name/Abbreviation: mCalci
CBI Antibody Core Code: A1083

"Lot" Number: 1 Position: 33aa
% Identical Homology of Target to Mouse Protein: 96% (NP_031613.1| calcitonin/calcitonin-related polypeptide, alpha; alpha CGRP; calcitonin/alpha CGRP)
Molecular Weight of GST-fusion: 33.52 KDa

Target sequence used to make this antibody:
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP






Sequence Name: mCalci
Full name: mouse calcitonin
UniGene Number: N.A.
Accession Number: P70160
Source organism: mouse ( Mus musculus )
Full length size (aa): To be posted
NCBI information page:

Full length sequence:





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.