Links to multiple antibodies on this page for xCT: xCT xCT-alt Western result: + | | GST
 | GST-xCT A1151a (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: xCT CBI Antibody Core Code: A1151a "Lot" Number: 1 Position: 45 (1-45) % Identical Homology of Target to Mouse Protein: 100% (NP_036120.1| solute carrier family 7 (cationic amino acid transporter, y+ system), member 11; sodium independent anionic amino acid transport system; System x; amino acid transport system xc-; cystine/glutamate transporter) Molecular Weight of fusion protein: 18.95 KDa Target sequence used to make this antibody: MVRKPVVATISKGGYLQGNMSGRLPSMGDQEPPGQEKVVL
KKKIT
Antibody Name/Abbreviation: xCT-alt CBI Antibody Core Code: A1152 "Lot" Number: 1 Position: 21 (482-502) % Identical Homology of Target to Mouse Protein: 100% (NP_036120.1| solute carrier family 7 (cationic amino acid transporter, y+ system), member 11; sodium independent anionic amino acid transport system; System x; amino acid transport system xc-; cystine/glutamate transporter) Molecular Weight of fusion protein: 32.31 KDa Target sequence used to make this antibody: DRITRTLQIILEVVPEDSKEL
| | Sequence Name: xCT Full name: SLC7A11 UniGene Number: N.A. Accession Number: Q9WTR6 Source organism: mouse ( Mus musculus ) Full length size (aa): 502 NCBI information page: Full length sequence: MVRKPVVATISKGGYLQGNMSGRLPSMGDQEPPGQEKVVLKKKITLLRGV
SIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAEL
GTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYI
LEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLT
AILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWF
YLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELLQS
SAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGH
LPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFM
GLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFST
GVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITRTLQIILEVVPEDSK
EL
|