mouse ( Mus musculus )
LocalIGF1-EA

Western result: +

control EA A1217 (fragment)

32.09 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: EA
CBI Antibody Core Code: A1217
"Lot" Number: 1 Position: 19 (135-153)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.09 KDa

Target sequence used to make this antibody:
EVHLKNTSRGSAGNKTYRM

Western result: +

GST GST-PanIGF A1218 (fragment)

21.92 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: PanIGF
CBI Antibody Core Code: A1218
"Lot" Number: 1 Position: 72 (47-118)
% Identical Homology of Target to Mouse Protein: 100% (NP_034642.1| insulin-like growth factor 1)
Molecular Weight of fusion protein: 21.92 KDa

Target sequence used to make this antibody:
TAGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRA
PQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Sequence Name: LocalIGF1-EA
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: mouse ( Mus musculus )
Full length size (aa): 153
NCBI information page:

Full length sequence:
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGP
ETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSC
DLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKEVHLKNTSRGSAGNKT
YRM