Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
Cd63 antigen


Antibody Name/Abbreviation: Cd63
CBI Antibody Core Code: A1290rat

"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: N.A.
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted






Sequence Name: Cd63 antigen
Full name: gi|1168849|sp|P41731|CD63_MOUSE CD63 antigen
UniGene Number: N.A.
Accession Number: P41731
Source organism: mouse ( Mus musculus )
Full length size (aa): 237
NCBI information page:

Full length sequence:
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAG
SLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAV
AIAGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASN
YTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLR
KNILLVAAAALGIAFVEVLGIIFSCCLVKSIRSGYEVM





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.