mouse ( Mus musculus )
crumbs homolog 3 (Drosophila)

Antibody Name/Abbreviation: Crb3
CBI Antibody Core Code: A1295
"Lot" Number: 2 Position: 23 (26-48)
% Identical Homology of Target to Mouse Protein: 100% (NP_808306.1| crumbs homolog 3)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
PDPFTNSTTQPPGDESNGGLSSG

Sequence Name: crumbs homolog 3 (Drosophila)
Full name: tr|Q8QZT4 Crumbs homolog 3 (Mus musculus 8 days embryo whole body cDNA, RIKEN full-length enriched library, clone:5730439B18 product:hypothetical protein, full insert sequence) - Mus musculus (Mouse)
UniGene Number: N.A.
Accession Number: Q8QZT4
Source organism: mouse ( Mus musculus )
Full length size (aa): 113
NCBI information page:

Full length sequence:
MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPGDESNGGLSSGAI
VAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQVGARAPP
PPNLKLPPEERLI