Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
epithelial membrane protein 3


Antibody Name/Abbreviation: Emp3
CBI Antibody Core Code: A1304

"Lot" Number: 1 Position: 40 (25-64)
% Identical Homology of Target to Mouse Protein: 100% (NP_034259.1| epithelial membrane protein 3)
Molecular Weight of fusion protein: 18.4 KDa

Target sequence used to make this antibody:
DKSWWTLPDKESLNLWYDCTWNTTTQTWACSNVSENGWLK






Sequence Name: epithelial membrane protein 3
Full name: gi|3023689|sp|O35912|EMP3_MOUSE Epithelial membrane protein-3 (EMP-3) (YMP protein) (Hematopoietic neural membrane protein) (HNMP-1
UniGene Number: N.A.
Accession Number: O35912
Source organism: mouse ( Mus musculus )
Full length size (aa): 163
NCBI information page:

Full length sequence:
MSLLLLVVSALHILILVLLFVATLDKSWWTLPDKESLNLWYDCTWNTTTQ
TWACSNVSENGWLKAVQALMVLSLILCCLSFILFMFQLYTMRRGGLFYAT
GLCQLCTSAAVFSGALIYAIHTEEILAKHPSGGSFGYCFALAWVAFPLAL
VSGIVYIHLRKRE





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.