mouse ( Mus musculus )
mApoAV-alt

Western result: +

GST GST-Apolipoprotein AV 1Ab073 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Apolipoprotein AV
CBI Antibody Core Code: 1Ab073
"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: 100%
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted

Antibody Name/Abbreviation: mApoAV-alt
CBI Antibody Core Code: A1002
"Lot" Number: 2 Position: 100 (17-116)
% Identical Homology of Target to Mouse Protein: 100% (NP_536682.2| apolipoprotein A-V)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
STQARKSLWDYFSQNSWSKGVMGQPQKLAQENLKGSFEQD
LYNMNNYLEKLGPLRGPGKEPPLLAQDPEGIRKQLQQELG
EVSSRLEPYMAAKHQQVGWN

Sequence Name: mApoAV-alt
Full name: apolipoprotein AV
UniGene Number: N.A.
Accession Number: NM_080434
Source organism: mouse ( Mus musculus )
Full length size (aa): 368
NCBI information page: click here

Sequence Notes: Alt. Accession Number: NP536682

Full length sequence:
maavitwalallavfastqarkslwdyfsqnswskgvmgqpqklaqenlk
gsfeqdlynmnnyleklgplrgpgkeppllaqdpegirkqlqqelgevss
rlepymaakhqqvgwnleglrqqlkpytaelmeqvglsvqelqeqlrvvg
edtkaqllggvdealnllqdmqsrvlhhtdrvkelfhpyaerlvtgighh
vqelhrsvaphaaasparlsrcvqtlshkltrkakdlhtsiqrnldqlrd
elsafirvstdgaedgdsldpqalseevrqrlqafrhdtylqiaaftqai
dqeteeiqhqlappppshsafapelghsdsnkalsrlqsrlddlwediay
glqdqghshlsdpeghsg