Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
Cbln1


Antibody Name/Abbreviation: Cbln1
CBI Antibody Core Code: A0723

"Lot" Number: 1 Position: 20(41-60)
% Identical Homology of Target to Mouse Protein: 100% (NP_062600.1| cerebellin 1 precursor protein)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
RRRSNFVRSLTKRSKFRLAL






Sequence Name: Cbln1
Full name: cerebellin 1 precursor protein
UniGene Number: N.A.
Accession Number: NP_062600.1
Source organism: mouse ( Mus musculus )
Full length size (aa): 95
NCBI information page: click here

Full length sequence:
MEAGERQEGSEKEAENYQGEEAAPPETSYVFVATLGTKVRRRRSNFVRSL
TKRSKFRLALHTPVSKINLAFPKPVAVIEEETCLVIMVPYPRPCP





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.