mouse ( Mus musculus )
Cdk2 beta

Antibody Name/Abbreviation: Cdk2 beta
CBI Antibody Core Code: A0315
"Lot" Number: 1 Position: 48aa (given)
% Identical Homology of Target to Mouse Protein: 100% (NP_904326.1| cyclin-dependent kinase 2 isoform 1)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
HLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGM
TAVSAPHP

Sequence Name: Cdk2 beta
Full name: Cdk2 beta
UniGene Number: N.A.
Accession Number: N.A.
Source organism: mouse ( Mus musculus )
Full length size (aa): To be posted
NCBI information page:

Full length sequence: