| Western result: + | | control
 | cyt-450 Cypf13 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: cyt-450 Cypf13 CBI Antibody Core Code: A0655 "Lot" Number: 1 Position: 20(437-456) % Identical Homology of Target to Mouse Protein: 100% (NP_570952.1| cytochrome P450, family 4, subfamily f, polypeptide 13; cytochrome P450,subfamily IVF, polypeptide 13; cytochrome P450 CYP4F13; leukotriene B4 omega hydroxylase; P450 CYP4F13) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: EVYNPFRFDPENPQKRSPLA
| | Sequence Name: cyt-450 Cypf13 Full name: cytochrome P450 CYP4F13 UniGene Number: Mm.22045 Accession Number: AF233643 Source organism: mouse ( Mus musculus ) Full length size (aa): 523 NCBI information page: click here Full length sequence: MLQLCLSWLGMGSLTASPWHLLLLGGASWILARILAWIYAFYDNCSRLRC
FPQPPKPSWFWGHLALMKNNEESMQFITHLGHDFHDVHLSWVGPVYPILR
LVHPNFIAPLLQASAAVAPKEMTLYGFLKPWLGDGLLMSAGDKWSHHRRL
LTPAFHFDILKSYVKIFNKSVNIMHAKWQCLASKGTSRLDMFEHISLMTL
DSLQKCIFSVDSNCQESDSKYIAAILELSSLVVKRHRQPFLYLDLLYYLT
ADGRRFRKACDLVHNFTDAVIKERRSTLNTQGVEFLKAKAKTKTLDFIDV
LLMAEDEHGKGLSNEDIRAEADTFMFGGHDTTTSALSWILYNLARHPEYQ
ERCRQEVQELLRDRDSEEIEWDDLAQLPFLTMCIKESLRLHPPVLLISRC
CTQDVLLPDGRAIPKGNICVISIFGVHHNPSVWPDPEVYNPFRFDPENPQ
KRSPLAFIPFSAGTRNCIGQTFAMSEIKVALALTLLRFRILPDDKEPRRK
PELILRAEGGLWLRVEPLSAGAQ
|