Links to multiple antibodies on this page for mGlx1: mGlx1-C mGlx1-N Antibody Name/Abbreviation: mGlx1-C CBI Antibody Core Code: A0254 "Lot" Number: 1 Position: 100(85-184) % Identical Homology of Target to Mouse Protein: 100% (NP_079650.2| glyoxalase 1; glyoxalase 1 complex; glyoxalase 1 regulatory; glyoxalase 1 structural) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: KSEKTAWMFSRKATLELTHNWGTEDDETQSYHNGNSDPRG
FGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFI
QDPDGYWIEILNPNKIATII
Antibody Name/Abbreviation: mGlx1-N CBI Antibody Core Code: A0253 "Lot" Number: 1 Position: 100(1-100) % Identical Homology of Target to Mouse Protein: 100% (NP_079650.2| glyoxalase 1; glyoxalase 1 complex; glyoxalase 1 regulatory; glyoxalase 1 structural) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIK
DPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKND
IPKDKSEKTAWMFSRKATLE
| | Sequence Name: mGlx1 Full name: glyoxalase 1 UniGene Number: N.A. Accession Number: NP_079650 Source organism: mouse ( Mus musculus ) Full length size (aa): 184 NCBI information page: click here Full length sequence: MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYT
RVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWMFSRKATLE
LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV
KKPDDGKMKGLAFIQDPDGYWIEILNPNKIATII
|