mouse ( Mus musculus )
KCNC1a (Kv3.1a)

Western result: +

control KCNC1a (Kv3.1a) A0633 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: KCNC1a (Kv3.1a)
CBI Antibody Core Code: A0633
"Lot" Number: 1 Position: 10(502-511)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
GRKPLRGMSI

Western result: +

control KCNC1 (Kv3.1) A0631 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: KCNC1 (Kv3.1)
CBI Antibody Core Code: A0631
"Lot" Number: 1 Position: 14(370-383)
% Identical Homology of Target to Mouse Protein: 100% (NP_032447.1| potassium voltage gated channel, Shaw-related subfamily, member 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
GAQPNDPSASEHTH

Sequence Name: KCNC1a (Kv3.1a)
Full name: neuroblastoma-Rat glioma hybrid cell line mRNA for a potassium channel protein NGK2
UniGene Number: N.A.
Accession Number: Y07521.1
Source organism: mouse ( Mus musculus )
Full length size (aa): 511
NCBI information page: click here

Full length sequence:
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDP
RADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD
VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELE
MTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFI
LVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEG
VCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLII
FLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTT
LGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQ
KLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPLAQEEILEINR
AGRKPLRGMSI